(data stored in ACNUC29543 zone)

EMBL: CT978603.PE127

CT978603.PE127       Location/Qualifiers
FT   CDS             122708..122926
FT                   /transl_table=11
FT                   /gene="SynRCC307_0127"
FT                   /locus_tag="SynRCC307_0127"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27030"
FT                   /db_xref="GOA:A5GQ71"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ71"
FT                   /protein_id="CAK27030.1"
FT                   /translation="MNSRLLLALATPLLVLLALLGLFGVGQRQGAERLQALPAVLIGSG
FT                   LLVAGSAGYGRRRRQLLRALREREPTP"
     MNSRLLLALA TPLLVLLALL GLFGVGQRQG AERLQALPAV LIGSGLLVAG SAGYGRRRRQ        60
     LLRALREREP TP                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page