(data stored in ACNUC29543 zone)

EMBL: CT978603.PE14

CT978603.PE14        Location/Qualifiers
FT   CDS             16813..17427
FT                   /transl_table=11
FT                   /gene="SynRCC307_0014"
FT                   /locus_tag="SynRCC307_0014"
FT                   /product="RNA-binding protein, RRM domain"
FT                   /note="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26917"
FT                   /db_xref="GOA:A5GPV8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV8"
FT                   /protein_id="CAK26917.1"
FT                   /translation="MSIFVGNLPFRAEQEDIIELFASFGEVANCSLPLERDTGRKRGFA
FT                   FVEMADEATEERAIEGLQGTELMGRPLRINKAEPRGSRGGGGGGGYGGGGGGRGGYGGG
FT                   GGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGGERASGARGWEDRSYGGG
FT                   GGGGEPSRDSFDEGRSRRRRGGGGGGESSGGDWGDYGGAEG"
     MSIFVGNLPF RAEQEDIIEL FASFGEVANC SLPLERDTGR KRGFAFVEMA DEATEERAIE        60
     GLQGTELMGR PLRINKAEPR GSRGGGGGGG YGGGGGGRGG YGGGGGGRGG YGGGGGGYGG       120
     GGGGYGGGGG GYGGGGGGYG GGGGGGERAS GARGWEDRSY GGGGGGGEPS RDSFDEGRSR       180
     RRRGGGGGGE SSGGDWGDYG GAEG                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page