(data stored in ACNUC29543 zone)

EMBL: CT978603.PE141

CT978603.PE141       Location/Qualifiers
FT   CDS             136355..136843
FT                   /transl_table=11
FT                   /gene="SynRCC307_0141"
FT                   /locus_tag="SynRCC307_0141"
FT                   /product="S-isoprenylcysteine O-methyltransferase related
FT                   enzyme"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27044"
FT                   /db_xref="GOA:A5GQ85"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ85"
FT                   /protein_id="CAK27044.1"
FT                   /translation="MMRDWGLSWGGWLDNRRGEWWLLGQLVLIALDIAMPAWPSLWRSP
FT                   PGVMVVGVVVLIGGLVLAAVAFVQLGSSLTPLPEPMPNAELKAQGLYGFCRHPLYLAVL
FT                   VCALGMALIKGGVLHPLLLLGLVVLLRVKAKREEQALLRHYPDYGAYQQRVPAFFPGL"
     MMRDWGLSWG GWLDNRRGEW WLLGQLVLIA LDIAMPAWPS LWRSPPGVMV VGVVVLIGGL        60
     VLAAVAFVQL GSSLTPLPEP MPNAELKAQG LYGFCRHPLY LAVLVCALGM ALIKGGVLHP       120
     LLLLGLVVLL RVKAKREEQA LLRHYPDYGA YQQRVPAFFP GL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page