(data stored in ACNUC29543 zone)

EMBL: CT978603.PE142

CT978603.PE142       Location/Qualifiers
FT   CDS             complement(136845..137189)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0142"
FT                   /locus_tag="SynRCC307_0142"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27045"
FT                   /db_xref="GOA:A5GQ86"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ86"
FT                   /protein_id="CAK27045.1"
FT                   /translation="MLGIRGVCRRALPLSSSDWITLASGSALWALALYIPLSGPLSRLE
FT                   AELSGTGLSESLQTTILVLSSLLLAAAIGLISQIAMSWALGPSWGASLGLMAVLSGAFW
FT                   SLASRREQDD"
     MLGIRGVCRR ALPLSSSDWI TLASGSALWA LALYIPLSGP LSRLEAELSG TGLSESLQTT        60
     ILVLSSLLLA AAIGLISQIA MSWALGPSWG ASLGLMAVLS GAFWSLASRR EQDD             114
//

If you have problems or comments...

PBIL Back to PBIL home page