(data stored in ACNUC29543 zone)

EMBL: CT978603.PE144

CT978603.PE144       Location/Qualifiers
FT   CDS             138078..138932
FT                   /transl_table=11
FT                   /gene="SynRCC307_0144"
FT                   /locus_tag="SynRCC307_0144"
FT                   /product="Galactose mutarotase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27047"
FT                   /db_xref="GOA:A5GQ88"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ88"
FT                   /protein_id="CAK27047.1"
FT                   /translation="MPLQELSAPYDHSVFTAENGDLIRVVPERGGLLTGWQVQGREIIY
FT                   LDLERFLTPGQSVRGGAPILFPICGNLPGDSLPLPDGRTATLKQHGFARNLPWSLSALS
FT                   DGRGVRLELSDSEQTRSEFPFEFLLQLDYRLAPGVLEVAMTLHNRSDQPLPFSFGLHPY
FT                   FSVSGLTSLSFEGMPEQGFDHKPMAAANTASVLTQLDQGIDLLVRPAGNVALVDAAAGQ
FT                   KLTMELSDPWNLAVFWTDPPRSMVCMEPWTGPRQSLISGDRKLELAPGEQRSLCTRYVV
FT                   STV"
     MPLQELSAPY DHSVFTAENG DLIRVVPERG GLLTGWQVQG REIIYLDLER FLTPGQSVRG        60
     GAPILFPICG NLPGDSLPLP DGRTATLKQH GFARNLPWSL SALSDGRGVR LELSDSEQTR       120
     SEFPFEFLLQ LDYRLAPGVL EVAMTLHNRS DQPLPFSFGL HPYFSVSGLT SLSFEGMPEQ       180
     GFDHKPMAAA NTASVLTQLD QGIDLLVRPA GNVALVDAAA GQKLTMELSD PWNLAVFWTD       240
     PPRSMVCMEP WTGPRQSLIS GDRKLELAPG EQRSLCTRYV VSTV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page