(data stored in ACNUC29543 zone)

EMBL: CT978603.PE152

CT978603.PE152       Location/Qualifiers
FT   CDS             complement(147099..148244)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0152"
FT                   /locus_tag="SynRCC307_0152"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27055"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ96"
FT                   /protein_id="CAK27055.1"
FT                   /translation="MSEQRRSWLVLLITTVVCLGAAEVFARLLPKNYYEWQHRYMFISE
FT                   GVNTNKTFADGTTAQWYKPDSAINWAVFYGYPWQKPKQEYSIWSTTNNLGLVQASDAQL
FT                   GKPSIAIFGDSFTEPQATTPWFYSLENHWKRLDPQGNSQLLNFGFQGTGIGRWDQVSRN
FT                   LSEPYNFQKVIYVAIGQDFARLGETGWNERDLQCLDNAEKCRKNHYYQAIAGDDQSEAK
FT                   LQERTQQLMAKRNNTLDKKLRYGLCGISELARQVASVIGSPCFDGSPPTDYQSNLKTAV
FT                   GHGLHLFRQQVARYGANNVFLVWIPERNEAATSRVSPISQQLLKVADHDLPKGHVIRCP
FT                   LTAADFYDKDGHQNEAGSRIIYNCVAQALTQASEGNDQKIE"
     MSEQRRSWLV LLITTVVCLG AAEVFARLLP KNYYEWQHRY MFISEGVNTN KTFADGTTAQ        60
     WYKPDSAINW AVFYGYPWQK PKQEYSIWST TNNLGLVQAS DAQLGKPSIA IFGDSFTEPQ       120
     ATTPWFYSLE NHWKRLDPQG NSQLLNFGFQ GTGIGRWDQV SRNLSEPYNF QKVIYVAIGQ       180
     DFARLGETGW NERDLQCLDN AEKCRKNHYY QAIAGDDQSE AKLQERTQQL MAKRNNTLDK       240
     KLRYGLCGIS ELARQVASVI GSPCFDGSPP TDYQSNLKTA VGHGLHLFRQ QVARYGANNV       300
     FLVWIPERNE AATSRVSPIS QQLLKVADHD LPKGHVIRCP LTAADFYDKD GHQNEAGSRI       360
     IYNCVAQALT QASEGNDQKI E                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page