(data stored in ACNUC29543 zone)

EMBL: CT978603.PE160

CT978603.PE160       Location/Qualifiers
FT   CDS             156171..158213
FT                   /transl_table=11
FT                   /gene="SynRCC307_0160"
FT                   /locus_tag="SynRCC307_0160"
FT                   /product="Selenophosphate synthase fused with a
FT                   FAD/NAD(P)-binding domain"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27063"
FT                   /db_xref="GOA:A5GQA4"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA4"
FT                   /protein_id="CAK27063.1"
FT                   /translation="MAAGQPHRLPVSHLLLAGGGHSHALLLRQWAMRPSTRPAVEAITL
FT                   VSAQPTSLYSGLIPACISGALAPKACVLDVWGLCRAAAVSFVQATVTGLDTANRQLSLK
FT                   GDRPPLAYDWLSLNLGAEVRAPKRLGCLPIKPLEPVLAALAALPLGAAVRVVGSGPAAV
FT                   EVSLALAARGFAVNLSGQPERAFWQGFRDSLNAAGVVLDPSLMRAHVELELHCTGSWGP
FT                   SWLAQSGLAVDGRGRVLTGADLRSVNDSSVFASGDCGVIDGRERPPSGVWAVRAAPVLA
FT                   ANLQRAVSRRRLRRWRPQPHALQLLGDGRGRAWALWAGRQLGPSRRIWRWKQHLDQRFM
FT                   AMLRPPQMASDQPMACSGCAAKLADAPLRGALQQLAGGQLPPAEDAAVAGDGWLQSVDG
FT                   FPALVADPYLNGRLTALHASSDLWACGASLRHGQALVTLPRCSELLQQELLVQSLAGVQ
FT                   SVMPLIGGHTLQALEASDPSKPLAKQLSLGLVVNGQLSPGQLSWGKGPLRPGHVLLLSR
FT                   PIGTGVLFAAAQAGSAEPQWLIAALEVMQQSQAPLVELLAAHGCSACTDVTGFGLLGHL
FT                   NEMLDASMGVDVQLQADQVPALAGSLELLEAGITSTLAPSNAVALARWPELLGTRARLL
FT                   IDPQTCGPLLAAVPEQQAGPCLAAMRLAGFSQAVRIGTVQSKGLL"
     MAAGQPHRLP VSHLLLAGGG HSHALLLRQW AMRPSTRPAV EAITLVSAQP TSLYSGLIPA        60
     CISGALAPKA CVLDVWGLCR AAAVSFVQAT VTGLDTANRQ LSLKGDRPPL AYDWLSLNLG       120
     AEVRAPKRLG CLPIKPLEPV LAALAALPLG AAVRVVGSGP AAVEVSLALA ARGFAVNLSG       180
     QPERAFWQGF RDSLNAAGVV LDPSLMRAHV ELELHCTGSW GPSWLAQSGL AVDGRGRVLT       240
     GADLRSVNDS SVFASGDCGV IDGRERPPSG VWAVRAAPVL AANLQRAVSR RRLRRWRPQP       300
     HALQLLGDGR GRAWALWAGR QLGPSRRIWR WKQHLDQRFM AMLRPPQMAS DQPMACSGCA       360
     AKLADAPLRG ALQQLAGGQL PPAEDAAVAG DGWLQSVDGF PALVADPYLN GRLTALHASS       420
     DLWACGASLR HGQALVTLPR CSELLQQELL VQSLAGVQSV MPLIGGHTLQ ALEASDPSKP       480
     LAKQLSLGLV VNGQLSPGQL SWGKGPLRPG HVLLLSRPIG TGVLFAAAQA GSAEPQWLIA       540
     ALEVMQQSQA PLVELLAAHG CSACTDVTGF GLLGHLNEML DASMGVDVQL QADQVPALAG       600
     SLELLEAGIT STLAPSNAVA LARWPELLGT RARLLIDPQT CGPLLAAVPE QQAGPCLAAM       660
     RLAGFSQAVR IGTVQSKGLL                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page