(data stored in ACNUC29543 zone)

EMBL: CT978603.PE161

CT978603.PE161       Location/Qualifiers
FT   CDS             158210..160225
FT                   /transl_table=11
FT                   /gene="SynRCC307_0161"
FT                   /locus_tag="SynRCC307_0161"
FT                   /product="Uncharacterized conserved membrane protein,
FT                   specific for cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27064"
FT                   /db_xref="GOA:A5GQA5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA5"
FT                   /protein_id="CAK27064.1"
FT                   /translation="MKRLFWPLLALLWLLSTVLDRRWLALDQRLPSWDQADYLNSALDH
FT                   GRALGLLPGGSWQGWSALLDHSPKIPPLASLVNGTVMAVSGDSPDQAAWTLSLWFGLLL
FT                   VGVALWGRQWQGPGLGLLAALFCVVAPGLAEWRVDYVLEIPLCAGCIWAQWLLGRWLRP
FT                   NGATWIAALLAALAIASALLIKQSALLVLLGPALWAVVVGLQERKRRWQLLASFGFVLA
FT                   LVAPWLGHNLITAIGGTNRATLESAAREGDPNATSLAGWLWYPKRLSGLIGQIPLIGGL
FT                   AGAVVAARRPSWPRGDGAWLWFVVLSGWLLTTLSPNKDPRYLAPLLPLLALLLARTWLV
FT                   LLAVMPKSWGQPLLGVGLLVSAWGTVQTRFQGILWAPVFPQPIEQIVDAAQGADPSTAR
FT                   TLIVVPSRPQLNQHSISFLGRRGGGGLVGRQLGSSSADIQPALKQAKQVLLATGDQGSV
FT                   RRSAEQFSQAIRSSGSFALQQQWPRPEGGTYELWARRPEASQPVPFEQRFPQLAAGLAL
FT                   GPAGLDPVFAAVGVEHQLDGHRLYQQRVEQQATAALAADPNDRQALWSLALLKVLQNRP
FT                   LEADHWFERLQKLEPKSPWPAAYRAVVLTAAGRLWQARAVADQAQGLNPSPVLEGLGDL
FT                   SGVLGGQLWRLPAASRSLPAATQAVEQQLKTPESAR"
     MKRLFWPLLA LLWLLSTVLD RRWLALDQRL PSWDQADYLN SALDHGRALG LLPGGSWQGW        60
     SALLDHSPKI PPLASLVNGT VMAVSGDSPD QAAWTLSLWF GLLLVGVALW GRQWQGPGLG       120
     LLAALFCVVA PGLAEWRVDY VLEIPLCAGC IWAQWLLGRW LRPNGATWIA ALLAALAIAS       180
     ALLIKQSALL VLLGPALWAV VVGLQERKRR WQLLASFGFV LALVAPWLGH NLITAIGGTN       240
     RATLESAARE GDPNATSLAG WLWYPKRLSG LIGQIPLIGG LAGAVVAARR PSWPRGDGAW       300
     LWFVVLSGWL LTTLSPNKDP RYLAPLLPLL ALLLARTWLV LLAVMPKSWG QPLLGVGLLV       360
     SAWGTVQTRF QGILWAPVFP QPIEQIVDAA QGADPSTART LIVVPSRPQL NQHSISFLGR       420
     RGGGGLVGRQ LGSSSADIQP ALKQAKQVLL ATGDQGSVRR SAEQFSQAIR SSGSFALQQQ       480
     WPRPEGGTYE LWARRPEASQ PVPFEQRFPQ LAAGLALGPA GLDPVFAAVG VEHQLDGHRL       540
     YQQRVEQQAT AALAADPNDR QALWSLALLK VLQNRPLEAD HWFERLQKLE PKSPWPAAYR       600
     AVVLTAAGRL WQARAVADQA QGLNPSPVLE GLGDLSGVLG GQLWRLPAAS RSLPAATQAV       660
     EQQLKTPESA R                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page