(data stored in ACNUC29543 zone)

EMBL: CT978603.PE169

CT978603.PE169       Location/Qualifiers
FT   CDS             complement(167397..168170)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0169"
FT                   /locus_tag="SynRCC307_0169"
FT                   /product="Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /note="Possible frameshift with RCC0170"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27072"
FT                   /db_xref="GOA:A5GQB3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB3"
FT                   /protein_id="CAK27072.1"
FT                   /translation="MTSSLPIQSQAPAAGSTTSPQDEIDLREVIAALRRQWRWIGAGAG
FT                   VGLGAAALSLLTTKPVYQGEFQILLDDKNSSSSMARVLANNPALALLGTSGVNSETQTE
FT                   IAILNSPSVLLPVFKAVQARKPKEVAEKMRFSDWRDSALSIENAKGTSVLNVEFRDTDK
FT                   TIIAPITQLLSNEYQKYSNRGRNRELSNMSTYLQQEINKIKPISLASNREALEFGFANG
FT                   LGRARRACPWPGSRGGEFRGNNSNFPGGRGRRGQR"
     MTSSLPIQSQ APAAGSTTSP QDEIDLREVI AALRRQWRWI GAGAGVGLGA AALSLLTTKP        60
     VYQGEFQILL DDKNSSSSMA RVLANNPALA LLGTSGVNSE TQTEIAILNS PSVLLPVFKA       120
     VQARKPKEVA EKMRFSDWRD SALSIENAKG TSVLNVEFRD TDKTIIAPIT QLLSNEYQKY       180
     SNRGRNRELS NMSTYLQQEI NKIKPISLAS NREALEFGFA NGLGRARRAC PWPGSRGGEF       240
     RGNNSNFPGG RGRRGQR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page