(data stored in ACNUC29543 zone)

EMBL: CT978603.PE175

CT978603.PE175       Location/Qualifiers
FT   CDS             complement(175010..176698)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0175"
FT                   /locus_tag="SynRCC307_0175"
FT                   /product="Asparagine synthase"
FT                   /EC_number="6.3.5.4"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27078"
FT                   /db_xref="GOA:A5GQB9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB9"
FT                   /protein_id="CAK27078.1"
FT                   /translation="MCGLFGAWGWSQQLDTTAALEALKSRGPDDQGEFHDPCGLSLLHT
FT                   RLAIQDLSPLGHQPMQASDQSLVLVFNGEIYNQHKLRRELEAAGYNFRSHSDTEVLLNG
FT                   FHHWKQDLWHRLEGIFAVACWEPHDQRLTLARDRFGVKPLLWQRKPQRLAFASELSALI
FT                   ASGCCNKEALNPKAIESYLLWGSVAAPNTIVDGVQVFPAGHWASWELGESWQLRLFSPD
FT                   QPPAQRSDLNLSAATEQTRFALQQAVQRQSIGDRPVGLFLSGGLDSGLLAAELRRQQQG
FT                   AIHSVSVGFEGLPGAVDETDLAGQTADALELTHQRLGIGPQQLDHSFDGFLEAIDQPTI
FT                   DGFNSHLVTQAAHDQGMVVAFSGLGADELFGGYSHMQPGPLKGQLQARRLKLHGINQQS
FT                   RQALEQTRSSGLPSDLSLSECSELELRGYLHDTLLRDSDAVSMAQGLELRVPFLDSELV
FT                   DLALSIPADLHRAEGPKTLLRRLARNQLPEAVLNAPKRGFNLALAPWLLQHQRFHPTRI
FT                   WSLLQKQPLQLSRRSFWGSWILLRLSGRFKPYWRYVVLAEWLAQC"
     MCGLFGAWGW SQQLDTTAAL EALKSRGPDD QGEFHDPCGL SLLHTRLAIQ DLSPLGHQPM        60
     QASDQSLVLV FNGEIYNQHK LRRELEAAGY NFRSHSDTEV LLNGFHHWKQ DLWHRLEGIF       120
     AVACWEPHDQ RLTLARDRFG VKPLLWQRKP QRLAFASELS ALIASGCCNK EALNPKAIES       180
     YLLWGSVAAP NTIVDGVQVF PAGHWASWEL GESWQLRLFS PDQPPAQRSD LNLSAATEQT       240
     RFALQQAVQR QSIGDRPVGL FLSGGLDSGL LAAELRRQQQ GAIHSVSVGF EGLPGAVDET       300
     DLAGQTADAL ELTHQRLGIG PQQLDHSFDG FLEAIDQPTI DGFNSHLVTQ AAHDQGMVVA       360
     FSGLGADELF GGYSHMQPGP LKGQLQARRL KLHGINQQSR QALEQTRSSG LPSDLSLSEC       420
     SELELRGYLH DTLLRDSDAV SMAQGLELRV PFLDSELVDL ALSIPADLHR AEGPKTLLRR       480
     LARNQLPEAV LNAPKRGFNL ALAPWLLQHQ RFHPTRIWSL LQKQPLQLSR RSFWGSWILL       540
     RLSGRFKPYW RYVVLAEWLA QC                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page