(data stored in ACNUC29543 zone)

EMBL: CT978603.PE197

CT978603.PE197       Location/Qualifiers
FT   CDS             198371..199279
FT                   /transl_table=11
FT                   /gene="SynRCC307_0197"
FT                   /locus_tag="SynRCC307_0197"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27100"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE1"
FT                   /protein_id="CAK27100.1"
FT                   /translation="MLYSPVSITVYNRFFHFKKCIENLKKNVLADKTTLFIFSDAPRLG
FT                   DEENVQKVRDYAKNIDGFKDVRLHFQTTNNFAKNGYESRRIPISEFGSVIRMEDDILTA
FT                   PGFLTFLNHAYQFYQNNPSIVNITGYCPPLRINSDYSKDYFILKRPCAWGWLYDQEILD
FT                   IVESQIDIGELNSFIKNSRHKITECGEDVLRMAFKDATKQIQAGDVRSMFYQIKYNKYT
FT                   IYPRYSLVQNIGHDGSGLHCGSTKKFMHDILWDKVDNFDFELLPKPDPEIVRANYQFRS
FT                   RPLSTAIKIKLKDTIRAWLQS"
     MLYSPVSITV YNRFFHFKKC IENLKKNVLA DKTTLFIFSD APRLGDEENV QKVRDYAKNI        60
     DGFKDVRLHF QTTNNFAKNG YESRRIPISE FGSVIRMEDD ILTAPGFLTF LNHAYQFYQN       120
     NPSIVNITGY CPPLRINSDY SKDYFILKRP CAWGWLYDQE ILDIVESQID IGELNSFIKN       180
     SRHKITECGE DVLRMAFKDA TKQIQAGDVR SMFYQIKYNK YTIYPRYSLV QNIGHDGSGL       240
     HCGSTKKFMH DILWDKVDNF DFELLPKPDP EIVRANYQFR SRPLSTAIKI KLKDTIRAWL       300
     QS                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page