(data stored in ACNUC29543 zone)

EMBL: CT978603.PE2

CT978603.PE2         Location/Qualifiers
FT   CDS             1314..2042
FT                   /transl_table=11
FT                   /gene="SynRCC307_0002"
FT                   /locus_tag="SynRCC307_0002"
FT                   /product="RNA metabolism-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26905"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU6"
FT                   /protein_id="CAK26905.1"
FT                   /translation="MPLPRQILISELLRSRLRDELGQDLGVGHQVWMHPPCHRLLGWSS
FT                   RPSAFGPRRSVWRLDQLVDWLEGQVEVEGEPADTEQPTLDLLPTLMEATLLGQQQQPLG
FT                   RLVDAVVDVQSGRINHYLVARSDPRLPGSSRWRLEPDRLIDQQPGQVQAALQELDDLPL
FT                   DRASIRQQMLRRSRQIRDQVPDSFDDFEGRLRSFGQRLWDGGEDLIERWRDEEPPVDER
FT                   RSRPRSRDWDDPDDGEDPWI"
     MPLPRQILIS ELLRSRLRDE LGQDLGVGHQ VWMHPPCHRL LGWSSRPSAF GPRRSVWRLD        60
     QLVDWLEGQV EVEGEPADTE QPTLDLLPTL MEATLLGQQQ QPLGRLVDAV VDVQSGRINH       120
     YLVARSDPRL PGSSRWRLEP DRLIDQQPGQ VQAALQELDD LPLDRASIRQ QMLRRSRQIR       180
     DQVPDSFDDF EGRLRSFGQR LWDGGEDLIE RWRDEEPPVD ERRSRPRSRD WDDPDDGEDP       240
     WI                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page