(data stored in ACNUC29543 zone)

EMBL: CT978603.PE202

CT978603.PE202       Location/Qualifiers
FT   CDS             204836..205603
FT                   /transl_table=11
FT                   /gene="SynRCC307_0202"
FT                   /locus_tag="SynRCC307_0202"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27105"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE6"
FT                   /protein_id="CAK27105.1"
FT                   /translation="MTATLFLCCPSLSFSGSTARTANSFNRLKNLLSVFDISVKTLFLS
FT                   SDQNDLASAEAHSYFDYIFFSPCEGVYAAFNAAIKKSLSLSADWIWLLGEGDTILCERL
FT                   DLSILSQNLSLGSHILMMNMFVGDRKLRCKLKEAFPSPLFSLDTMRFNHPASIISANAY
FT                   SINGLYSLDYKVVSDYYWLHKACAANLSITHLPFVSVYHELGGISTSSGKSRFFEHYQC
FT                   LLALNRVYGFSFSVFFALIFRLTRCLVSSFFAK"
     MTATLFLCCP SLSFSGSTAR TANSFNRLKN LLSVFDISVK TLFLSSDQND LASAEAHSYF        60
     DYIFFSPCEG VYAAFNAAIK KSLSLSADWI WLLGEGDTIL CERLDLSILS QNLSLGSHIL       120
     MMNMFVGDRK LRCKLKEAFP SPLFSLDTMR FNHPASIISA NAYSINGLYS LDYKVVSDYY       180
     WLHKACAANL SITHLPFVSV YHELGGISTS SGKSRFFEHY QCLLALNRVY GFSFSVFFAL       240
     IFRLTRCLVS SFFAK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page