(data stored in ACNUC29543 zone)

EMBL: CT978603.PE216

CT978603.PE216       Location/Qualifiers
FT   CDS             complement(214426..215877)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0216"
FT                   /locus_tag="SynRCC307_0216"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27119"
FT                   /db_xref="GOA:A5GQG0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG0"
FT                   /protein_id="CAK27119.1"
FT                   /translation="MSRLARGSKPATDRLLTVQAMTRLPRAGEQSRRGELVDRSRRAVQ
FT                   WLQPGLVVKRWVLTSALGFVLALLGAAIWADLKPIYWILTTVDDLLRVLAGAGREFTGP
FT                   LVLLVGIGLVLLGQSRSFGSIQRALAPQKDTALVDALLAQRRLNRGPNIVAIGGGTGLS
FT                   TLLSGLKRYSGNLTAIVTVADDGGSSGVLRRELGVQPPGDIRNCLAALAREEPLLTRLF
FT                   QYRFTAGGGLEGHSFGNLFLSALTAITGNLETAITASSKVLAVQGQVVPATSADVRLWA
FT                   ELENGERLEGESCIGQANSPIVRLGCTPSRPAALPRALEAIAHADMIVLGPGSLYTSLL
FT                   PNLLVPELVEAISRSQAPRLYICNLMTQPGETDGLDVSGHLRAIESQLASIGVQQRLFD
FT                   AVLAQDTLPSGPELDYYRARGAEPVDCDLDGLKQEGYRVMLASMQGPQQRSEGRAFKGT
FT                   LRHDSRSLALAVMRFYRAKQKRQIN"
     MSRLARGSKP ATDRLLTVQA MTRLPRAGEQ SRRGELVDRS RRAVQWLQPG LVVKRWVLTS        60
     ALGFVLALLG AAIWADLKPI YWILTTVDDL LRVLAGAGRE FTGPLVLLVG IGLVLLGQSR       120
     SFGSIQRALA PQKDTALVDA LLAQRRLNRG PNIVAIGGGT GLSTLLSGLK RYSGNLTAIV       180
     TVADDGGSSG VLRRELGVQP PGDIRNCLAA LAREEPLLTR LFQYRFTAGG GLEGHSFGNL       240
     FLSALTAITG NLETAITASS KVLAVQGQVV PATSADVRLW AELENGERLE GESCIGQANS       300
     PIVRLGCTPS RPAALPRALE AIAHADMIVL GPGSLYTSLL PNLLVPELVE AISRSQAPRL       360
     YICNLMTQPG ETDGLDVSGH LRAIESQLAS IGVQQRLFDA VLAQDTLPSG PELDYYRARG       420
     AEPVDCDLDG LKQEGYRVML ASMQGPQQRS EGRAFKGTLR HDSRSLALAV MRFYRAKQKR       480
     QIN                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page