(data stored in ACNUC29543 zone)

EMBL: CT978603.PE229

CT978603.PE229       Location/Qualifiers
FT   CDS             complement(229160..230053)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0229"
FT                   /locus_tag="SynRCC307_0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27132"
FT                   /db_xref="GOA:A5GQH3"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH3"
FT                   /protein_id="CAK27132.1"
FT                   /translation="MIQAGDSGTRLAIRLLQDAAERGEIEPWDVDVIAVVDGFLDQLRQ
FT                   KLELPRLIASAGGSYEQDLAESSEAFLAASVLVSLKAEHLEASTFQAAEVDDDDVDLLL
FT                   EQLAEDDGDWPALRALPSRPEKLLQRRTVAPPPLQRPVTLGELIRQLEDIGERLEQEGG
FT                   RQPKQRRKRYSDREAIAQVASLAHREKLPETTAALSQFLSRWDVGWEWQQFDGLVAAWA
FT                   AVAPEDLDQDRVGVFWALLFLCSQGRVDLQQDERDLFGPLQLRVRPSEEDQQRQGVLHF
FT                   VPPGSAALPASELKAA"
     MIQAGDSGTR LAIRLLQDAA ERGEIEPWDV DVIAVVDGFL DQLRQKLELP RLIASAGGSY        60
     EQDLAESSEA FLAASVLVSL KAEHLEASTF QAAEVDDDDV DLLLEQLAED DGDWPALRAL       120
     PSRPEKLLQR RTVAPPPLQR PVTLGELIRQ LEDIGERLEQ EGGRQPKQRR KRYSDREAIA       180
     QVASLAHREK LPETTAALSQ FLSRWDVGWE WQQFDGLVAA WAAVAPEDLD QDRVGVFWAL       240
     LFLCSQGRVD LQQDERDLFG PLQLRVRPSE EDQQRQGVLH FVPPGSAALP ASELKAA          297
//

If you have problems or comments...

PBIL Back to PBIL home page