(data stored in ACNUC29543 zone)

EMBL: CT978603.PE23

CT978603.PE23        Location/Qualifiers
FT   CDS             25826..26053
FT                   /transl_table=11
FT                   /gene="SynRCC307_0023"
FT                   /locus_tag="SynRCC307_0023"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26926"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW7"
FT                   /protein_id="CAK26926.1"
FT                   /translation="MDLRGTPCPLNFIRTQLALEKLASGEQLEVLLDAGEPDALVSAAL
FT                   QGDGAAAALVQEMQRQQQSDGSVRLLIIRA"
     MDLRGTPCPL NFIRTQLALE KLASGEQLEV LLDAGEPDAL VSAALQGDGA AAALVQEMQR        60
     QQQSDGSVRL LIIRA                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page