(data stored in ACNUC29543 zone)

EMBL: CT978603.PE234

CT978603.PE234       Location/Qualifiers
FT   CDS             complement(235111..235860)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0234"
FT                   /locus_tag="SynRCC307_0234"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27137"
FT                   /db_xref="GOA:A5GQH8"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH8"
FT                   /protein_id="CAK27137.1"
FT                   /translation="MQMHHSSVVMLILLIGFAVLHSGGASLRAWGAEKIGERAWRLLFA
FT                   AVSIPAAVVVIAYFLEHRYDGLRLWNLQDQPWIIPLVWIGTAVSFLFLYPATYNLLEIP
FT                   AVLKPQVRMYATGIIRVSRHPQAVGQILWCATHLLWIGSSFMVVTCVGLIGHHLFAVWN
FT                   GDRRQHNRFGEAFDELKANTSLIPFVAVLDGRQPLPWREFVRPAQLGIAIAVGVFWWAH
FT                   QWIGVAATSFARTGFAHWLDGAYGLMA"
     MQMHHSSVVM LILLIGFAVL HSGGASLRAW GAEKIGERAW RLLFAAVSIP AAVVVIAYFL        60
     EHRYDGLRLW NLQDQPWIIP LVWIGTAVSF LFLYPATYNL LEIPAVLKPQ VRMYATGIIR       120
     VSRHPQAVGQ ILWCATHLLW IGSSFMVVTC VGLIGHHLFA VWNGDRRQHN RFGEAFDELK       180
     ANTSLIPFVA VLDGRQPLPW REFVRPAQLG IAIAVGVFWW AHQWIGVAAT SFARTGFAHW       240
     LDGAYGLMA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page