(data stored in ACNUC29543 zone)

EMBL: CT978603.PE236

CT978603.PE236       Location/Qualifiers
FT   CDS             complement(236901..237518)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0236"
FT                   /locus_tag="SynRCC307_0236"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27139"
FT                   /db_xref="GOA:A5GQI0"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI0"
FT                   /protein_id="CAK27139.1"
FT                   /translation="MAPRRPPSRYDDDRYDERDRYERRPPQRGGSGGNKGGGGAGLTFN
FT                   TATIAVLAGILIIGIGIGTSLTSNTSGSQGNIASSEQLDLAVPDPEFCKQWGASAFVMD
FT                   VEMYTTMNPSTSFVTQPKLQPGCVIRRENWAVLQKAGAVTTDQMRDCKQRMNTFAYIGS
FT                   IRDKPIVRCVYQTDAGENKFQNPGIAGAADDTVGITPEADQF"
     MAPRRPPSRY DDDRYDERDR YERRPPQRGG SGGNKGGGGA GLTFNTATIA VLAGILIIGI        60
     GIGTSLTSNT SGSQGNIASS EQLDLAVPDP EFCKQWGASA FVMDVEMYTT MNPSTSFVTQ       120
     PKLQPGCVIR RENWAVLQKA GAVTTDQMRD CKQRMNTFAY IGSIRDKPIV RCVYQTDAGE       180
     NKFQNPGIAG AADDTVGITP EADQF                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page