(data stored in ACNUC29543 zone)

EMBL: CT978603.PE237

CT978603.PE237       Location/Qualifiers
FT   CDS             complement(237518..237868)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0237"
FT                   /locus_tag="SynRCC307_0237"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27140"
FT                   /db_xref="GOA:A5GQI1"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQI1"
FT                   /protein_id="CAK27140.1"
FT                   /translation="MSDTPLKCTTRHVRIFTATVEDNGELKASSDKLTLDLDPDNEFEW
FT                   DQPVLAKVQQRFAELVDAAAGTELSDYNLRRIGTDLEGFIRQLLQAGELRYNLGARVLN
FT                   YSMGLPRTPETL"
     MSDTPLKCTT RHVRIFTATV EDNGELKASS DKLTLDLDPD NEFEWDQPVL AKVQQRFAEL        60
     VDAAAGTELS DYNLRRIGTD LEGFIRQLLQ AGELRYNLGA RVLNYSMGLP RTPETL           116
//

If you have problems or comments...

PBIL Back to PBIL home page