(data stored in ACNUC29543 zone)

EMBL: CT978603.PE245

CT978603.PE245       Location/Qualifiers
FT   CDS             243739..244299
FT                   /transl_table=11
FT                   /gene="SynRCC307_0245"
FT                   /locus_tag="SynRCC307_0245"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27148"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI9"
FT                   /protein_id="CAK27148.1"
FT                   /translation="MRRLLRWSVVVLLLWGGWRLLPRLLEPWMPPPQMILVLGGDVERE
FT                   KQAAALARQSNLPVLITGGSNPEYAQWVFEGQGVDAQKLQLDYAARDTLSNFTTLVDRL
FT                   RRRGIRHVLLVTSSDHMDRALLVGRVVAGSRGIHLTPVPVPCGDDCRPERRSKVWGDGV
FT                   RALVWVVSGRDLKEEMQGAPAGR"
     MRRLLRWSVV VLLLWGGWRL LPRLLEPWMP PPQMILVLGG DVEREKQAAA LARQSNLPVL        60
     ITGGSNPEYA QWVFEGQGVD AQKLQLDYAA RDTLSNFTTL VDRLRRRGIR HVLLVTSSDH       120
     MDRALLVGRV VAGSRGIHLT PVPVPCGDDC RPERRSKVWG DGVRALVWVV SGRDLKEEMQ       180
     GAPAGR                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page