(data stored in ACNUC29543 zone)

EMBL: CT978603.PE25

CT978603.PE25        Location/Qualifiers
FT   CDS             complement(26914..27249)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0025"
FT                   /locus_tag="SynRCC307_0025"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26928"
FT                   /db_xref="GOA:A5GPW9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GPW9"
FT                   /protein_id="CAK26928.1"
FT                   /translation="MAGFGLPNFGQLTEAFKKAQQIQQDAQKLQEELDAMEIEGSSVDG
FT                   KASIWLSGNQQPLRVRLAPELLASGQEATEAATLEALQNAYAQSTATMKERMEELTGGL
FT                   NLPGLGG"
     MAGFGLPNFG QLTEAFKKAQ QIQQDAQKLQ EELDAMEIEG SSVDGKASIW LSGNQQPLRV        60
     RLAPELLASG QEATEAATLE ALQNAYAQST ATMKERMEEL TGGLNLPGLG G                111
//

If you have problems or comments...

PBIL Back to PBIL home page