(data stored in ACNUC29543 zone)

EMBL: CT978603.PE258

CT978603.PE258       Location/Qualifiers
FT   CDS             complement(256491..256754)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0258"
FT                   /locus_tag="SynRCC307_0258"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27161"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQK2"
FT                   /protein_id="CAK27161.1"
FT                   /translation="MFVVELSLKLSPMPISVQRKSLEAAQGLYGEIRQAMESGHPQLMD
FT                   LRCEKSEEKQICLRSSEIVSVQLYEKSAMGAGSKRPGFSTGG"
     MFVVELSLKL SPMPISVQRK SLEAAQGLYG EIRQAMESGH PQLMDLRCEK SEEKQICLRS        60
     SEIVSVQLYE KSAMGAGSKR PGFSTGG                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page