(data stored in ACNUC29543 zone)

EMBL: CT978603.PE260

CT978603.PE260       Location/Qualifiers
FT   CDS             complement(258219..259709)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0260"
FT                   /locus_tag="SynRCC307_0260"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27163"
FT                   /db_xref="GOA:A5GQK4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK4"
FT                   /protein_id="CAK27163.1"
FT                   /translation="MRPRLISTRSVWPLLLIGAALRLVNLHAPVLGVHSWRQADTAAIA
FT                   RNAFEAGLPLWLPQVDWGGASSGFAETDPPLYSQAVAWLYGWFGVKEWLARGLSLVLSL
FT                   LALWLLVRLGQRLLGADAGWWGGLLFAVLPLSVFYGRSIQPESLLLACSALALERGLAW
FT                   RHSGHYRDLSLASLGLTGAVLIKVLPALWLGLPLLWLAWLRHGPGLLRRLELWLVAAVV
FT                   LGVTGAWYWHAHQLFLQTGLSFGFWGAGANRYSWGELIGPGYWGNLLLRTSVRGLAVLG
FT                   LPLLVIGLLNKQLKAEARLLPIGLVSVLAAGALAPESSGVHEYYQLPLLLFACPLMGLG
FT                   WVQLWQQAGRRSRRWLTGSMALLLGCSLVVLNLEYWAKEVPDGNPTWELAQRIQRDTPQ
FT                   EARIISVSGGDPTLLYLAHRKGWLKGPGAITESWLKERQAEGATHIAGSWEVIQSYSPF
FT                   PENGAKARLRQLLGPQASHGPNYVVALPLQNDAPGSQP"
     MRPRLISTRS VWPLLLIGAA LRLVNLHAPV LGVHSWRQAD TAAIARNAFE AGLPLWLPQV        60
     DWGGASSGFA ETDPPLYSQA VAWLYGWFGV KEWLARGLSL VLSLLALWLL VRLGQRLLGA       120
     DAGWWGGLLF AVLPLSVFYG RSIQPESLLL ACSALALERG LAWRHSGHYR DLSLASLGLT       180
     GAVLIKVLPA LWLGLPLLWL AWLRHGPGLL RRLELWLVAA VVLGVTGAWY WHAHQLFLQT       240
     GLSFGFWGAG ANRYSWGELI GPGYWGNLLL RTSVRGLAVL GLPLLVIGLL NKQLKAEARL       300
     LPIGLVSVLA AGALAPESSG VHEYYQLPLL LFACPLMGLG WVQLWQQAGR RSRRWLTGSM       360
     ALLLGCSLVV LNLEYWAKEV PDGNPTWELA QRIQRDTPQE ARIISVSGGD PTLLYLAHRK       420
     GWLKGPGAIT ESWLKERQAE GATHIAGSWE VIQSYSPFPE NGAKARLRQL LGPQASHGPN       480
     YVVALPLQND APGSQP                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page