(data stored in ACNUC29543 zone)

EMBL: CT978603.PE261

CT978603.PE261       Location/Qualifiers
FT   CDS             259710..260660
FT                   /transl_table=11
FT                   /gene="SynRCC307_0261"
FT                   /locus_tag="SynRCC307_0261"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27164"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQK5"
FT                   /protein_id="CAK27164.1"
FT                   /translation="MPVNLRLLAPQSRRLMLHVGTVKTGSTSLQAYFAEHQQALAEAGW
FT                   CYLPAIGRPDRRDLAAACIAIDDQRDELLRALRLVAPQQRLAFRQQVKAELEEQLKAVP
FT                   DELGVILSSEHFHLSLQRPEEIETLKQLLLELGLEVQQVVIYLREPLALIESLFSTMVR
FT                   SGDQRPLPADPADPFVALICDHRASLQRWRAVFGEAVVQPRAFPPRAGGSLSADFLQLL
FT                   GNAPVAGWPPEPQRQRNRGLNPSALNLLAWLNRHCTWLTPQARFRWQRGLRRLLDGALS
FT                   RWASGSYRMPGPQRSRYGQLYSDGYAAWLRRELPQ"
     MPVNLRLLAP QSRRLMLHVG TVKTGSTSLQ AYFAEHQQAL AEAGWCYLPA IGRPDRRDLA        60
     AACIAIDDQR DELLRALRLV APQQRLAFRQ QVKAELEEQL KAVPDELGVI LSSEHFHLSL       120
     QRPEEIETLK QLLLELGLEV QQVVIYLREP LALIESLFST MVRSGDQRPL PADPADPFVA       180
     LICDHRASLQ RWRAVFGEAV VQPRAFPPRA GGSLSADFLQ LLGNAPVAGW PPEPQRQRNR       240
     GLNPSALNLL AWLNRHCTWL TPQARFRWQR GLRRLLDGAL SRWASGSYRM PGPQRSRYGQ       300
     LYSDGYAAWL RRELPQ                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page