(data stored in ACNUC29543 zone)

EMBL: CT978603.PE268

CT978603.PE268       Location/Qualifiers
FT   CDS             272021..272689
FT                   /transl_table=11
FT                   /gene="SynRCC307_0268"
FT                   /locus_tag="SynRCC307_0268"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27171"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL2"
FT                   /protein_id="CAK27171.1"
FT                   /translation="MTRDPYQVLGVSPSASAAEIKSAYRALVKQHHPDAADGISDDPER
FT                   ILEINAAWELLGDAEARQRFDAGRGERSARATAQARASSGKRRRGAANDAELERWLEQV
FT                   YHPVDRLLGQVLDPFPEQLRELSADPYDDTLMEAFCDYIERSQSKLQTAETLYRSMPCP
FT                   SSAQGFGLSLYHFLSGVQDAVMELERYTAGYVDDYLRDGREMIREACLRRQRIQDQLPA
FT                   "
     MTRDPYQVLG VSPSASAAEI KSAYRALVKQ HHPDAADGIS DDPERILEIN AAWELLGDAE        60
     ARQRFDAGRG ERSARATAQA RASSGKRRRG AANDAELERW LEQVYHPVDR LLGQVLDPFP       120
     EQLRELSADP YDDTLMEAFC DYIERSQSKL QTAETLYRSM PCPSSAQGFG LSLYHFLSGV       180
     QDAVMELERY TAGYVDDYLR DGREMIREAC LRRQRIQDQL PA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page