(data stored in ACNUC29543 zone)

EMBL: CT978603.PE271

CT978603.PE271       Location/Qualifiers
FT   CDS             complement(273870..274112)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0271"
FT                   /locus_tag="SynRCC307_0271"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27174"
FT                   /db_xref="GOA:A5GQL5"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL5"
FT                   /protein_id="CAK27174.1"
FT                   /translation="MESLKSWLDRLLVADVFVVIAGAFWFLTAVLCEARGIHQPLAVFQ
FT                   QLWEPLFTPAIGLLMAAAVISGVLGWWQRRTKTSG"
     MESLKSWLDR LLVADVFVVI AGAFWFLTAV LCEARGIHQP LAVFQQLWEP LFTPAIGLLM        60
     AAAVISGVLG WWQRRTKTSG                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page