(data stored in ACNUC29543 zone)

EMBL: CT978603.PE273

CT978603.PE273       Location/Qualifiers
FT   CDS             complement(275286..275717)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0273"
FT                   /locus_tag="SynRCC307_0273"
FT                   /product="TPR-repeat protein, specific for cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27176"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL7"
FT                   /protein_id="CAK27176.1"
FT                   /translation="MTEEQPSLSESQFGQALQRYQDGAEAADVIADFEAITRRDPRQAA
FT                   GWTCLAWLQLLTEQPEDALRSAKTAVKLNAQDPQGRLNLALAMLETGAKGVREHIEIVK
FT                   RVMVFSPELGQELEASIADGLQRRPGWPALLKVQAWLAD"
     MTEEQPSLSE SQFGQALQRY QDGAEAADVI ADFEAITRRD PRQAAGWTCL AWLQLLTEQP        60
     EDALRSAKTA VKLNAQDPQG RLNLALAMLE TGAKGVREHI EIVKRVMVFS PELGQELEAS       120
     IADGLQRRPG WPALLKVQAW LAD                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page