(data stored in ACNUC29543 zone)

EMBL: CT978603.PE274

CT978603.PE274       Location/Qualifiers
FT   CDS             complement(275760..276143)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0274"
FT                   /locus_tag="SynRCC307_0274"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27177"
FT                   /db_xref="GOA:A5GQL8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL8"
FT                   /protein_id="CAK27177.1"
FT                   /translation="MATETLTHTGKDGKGILITEPAMKQLANLMQQQGSGSVLRVGVRS
FT                   GGCSGMSYTMDFIDAAQIQGDDERYSYEPADAPSFEVVCDPKSLLYIYGMQLDFSTELI
FT                   GGGFNFTNPNASQTCGCGSSFAV"
     MATETLTHTG KDGKGILITE PAMKQLANLM QQQGSGSVLR VGVRSGGCSG MSYTMDFIDA        60
     AQIQGDDERY SYEPADAPSF EVVCDPKSLL YIYGMQLDFS TELIGGGFNF TNPNASQTCG       120
     CGSSFAV                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page