(data stored in ACNUC29543 zone)

EMBL: CT978603.PE276

CT978603.PE276       Location/Qualifiers
FT   CDS             277687..278133
FT                   /transl_table=11
FT                   /gene="SynRCC307_0276"
FT                   /locus_tag="SynRCC307_0276"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27179"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM0"
FT                   /protein_id="CAK27179.1"
FT                   /translation="MGRWLEHSVAVDIAAPVDLVWAVWSDLESMPLWMRWIESVKTLDD
FT                   PDLTEWTLAAQGFRFQWKARITQRVEAQQLHWQSVGGLPTKGAVRFYPEADERTAVKLT
FT                   VSYELPGVLAPLMDPKILGGLVSKELQANLDRFQELVEERARAR"
     MGRWLEHSVA VDIAAPVDLV WAVWSDLESM PLWMRWIESV KTLDDPDLTE WTLAAQGFRF        60
     QWKARITQRV EAQQLHWQSV GGLPTKGAVR FYPEADERTA VKLTVSYELP GVLAPLMDPK       120
     ILGGLVSKEL QANLDRFQEL VEERARAR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page