(data stored in ACNUC29543 zone)

EMBL: CT978603.PE277

CT978603.PE277       Location/Qualifiers
FT   CDS             278201..278656
FT                   /transl_table=11
FT                   /gene="SynRCC307_0277"
FT                   /locus_tag="SynRCC307_0277"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27180"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM1"
FT                   /protein_id="CAK27180.1"
FT                   /translation="MLSACGAQTPPQASTPPAAEANKDTANSLPEPTADPQLIPLYDPD
FT                   EVLGSLPRGRQDPFAPPPQALVAAQDDASDSGGDGVPELMGVSSVGGVAQAFVSYGSYS
FT                   GPVAPGDVGDPDRLPWLPTGVGVAGVDVQRGRLLLERDGRPLSPLQL"
     MLSACGAQTP PQASTPPAAE ANKDTANSLP EPTADPQLIP LYDPDEVLGS LPRGRQDPFA        60
     PPPQALVAAQ DDASDSGGDG VPELMGVSSV GGVAQAFVSY GSYSGPVAPG DVGDPDRLPW       120
     LPTGVGVAGV DVQRGRLLLE RDGRPLSPLQ L                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page