(data stored in ACNUC29543 zone)

EMBL: CT978603.PE282

CT978603.PE282       Location/Qualifiers
FT   CDS             complement(282636..282899)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0282"
FT                   /locus_tag="SynRCC307_0282"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27185"
FT                   /db_xref="GOA:A5GQM6"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM6"
FT                   /protein_id="CAK27185.1"
FT                   /translation="MAGGRNSACRQSSHGFCEVMGEFFANVTRYPRYLIAFGLGVASSV
FT                   FEPLLARTRNPVTAVALIGALISGLLTLTLVLRAMVTPVPLA"
     MAGGRNSACR QSSHGFCEVM GEFFANVTRY PRYLIAFGLG VASSVFEPLL ARTRNPVTAV        60
     ALIGALISGL LTLTLVLRAM VTPVPLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page