(data stored in ACNUC29543 zone)

EMBL: CT978603.PE290

CT978603.PE290       Location/Qualifiers
FT   CDS             288293..288571
FT                   /transl_table=11
FT                   /gene="SynRCC307_0290"
FT                   /locus_tag="SynRCC307_0290"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27193"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN4"
FT                   /protein_id="CAK27193.1"
FT                   /translation="MSPSRLVAMSDPLIRELDHYVVLDPAVGEQILSAAETRHWLAEQL
FT                   QRLKQLPADIAAVEGLPQQVEWLIDTACALEIEPGLTVQWFAVRLEP"
     MSPSRLVAMS DPLIRELDHY VVLDPAVGEQ ILSAAETRHW LAEQLQRLKQ LPADIAAVEG        60
     LPQQVEWLID TACALEIEPG LTVQWFAVRL EP                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page