(data stored in ACNUC29543 zone)

EMBL: CT978603.PE295

CT978603.PE295       Location/Qualifiers
FT   CDS             291030..292322
FT                   /transl_table=11
FT                   /gene="SynRCC307_0295"
FT                   /locus_tag="SynRCC307_0295"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27198"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN9"
FT                   /protein_id="CAK27198.1"
FT                   /translation="MTSACSTPQPCDGLIRFCSNSSPTVSESDHSAEALEARWHQQLAE
FT                   IPEQAWDALVASAGLPFYRWAWLEALERSGSIVPSQGWQACHLSLWREQQLIAVAPLYV
FT                   KGHSYGEFVFDQSFAQLAGQLGLRYYPKLLGMSPLSPILGYRFFIASNEEEGACTALML
FT                   RLIDRFCERNQLLSCNFLYVDPAWRPHAEAAGCSAWLNQQSLWSNPGYGSFEDYLASFN
FT                   ANQRRNIRRERKAVQQAGLQVSAIAAEAITPELLERMHGFYEDHCRRWGMWGSKYLTEE
FT                   FFSLAQQLRQHLVLFSAHRHGEDPHQPIAMSLCVREGDHLWGRYWGSTVEIDNLHFEVC
FT                   YYAPIEWAIAQGIRHYDPGAGGSHKRRRGFVARPHASLHRWYEPQFAGLIKRWLPLANA
FT                   QQLEEVEAINAELPFSGRQIPLAPEQGKIEG"
     MTSACSTPQP CDGLIRFCSN SSPTVSESDH SAEALEARWH QQLAEIPEQA WDALVASAGL        60
     PFYRWAWLEA LERSGSIVPS QGWQACHLSL WREQQLIAVA PLYVKGHSYG EFVFDQSFAQ       120
     LAGQLGLRYY PKLLGMSPLS PILGYRFFIA SNEEEGACTA LMLRLIDRFC ERNQLLSCNF       180
     LYVDPAWRPH AEAAGCSAWL NQQSLWSNPG YGSFEDYLAS FNANQRRNIR RERKAVQQAG       240
     LQVSAIAAEA ITPELLERMH GFYEDHCRRW GMWGSKYLTE EFFSLAQQLR QHLVLFSAHR       300
     HGEDPHQPIA MSLCVREGDH LWGRYWGSTV EIDNLHFEVC YYAPIEWAIA QGIRHYDPGA       360
     GGSHKRRRGF VARPHASLHR WYEPQFAGLI KRWLPLANAQ QLEEVEAINA ELPFSGRQIP       420
     LAPEQGKIEG                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page