(data stored in ACNUC29543 zone)

EMBL: CT978603.PE296

CT978603.PE296       Location/Qualifiers
FT   CDS             292336..292722
FT                   /transl_table=11
FT                   /gene="SynRCC307_0296"
FT                   /locus_tag="SynRCC307_0296"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27199"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP0"
FT                   /protein_id="CAK27199.1"
FT                   /translation="MAPLSPQQRRELDDAHSNRTIELDPSGYFLIRVDAAAGELVVQHF
FT                   GNAINDQGLATDPDTGEVLSCRGGGPRAASAEYRGRSAKELGMALTESAEPLPLSRLDH
FT                   ALYLGRELQKAELCLEQGLDYVQD"
     MAPLSPQQRR ELDDAHSNRT IELDPSGYFL IRVDAAAGEL VVQHFGNAIN DQGLATDPDT        60
     GEVLSCRGGG PRAASAEYRG RSAKELGMAL TESAEPLPLS RLDHALYLGR ELQKAELCLE       120
     QGLDYVQD                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page