(data stored in ACNUC29543 zone)

EMBL: CT978603.PE298

CT978603.PE298       Location/Qualifiers
FT   CDS             294317..294484
FT                   /transl_table=11
FT                   /gene="SynRCC307_0298"
FT                   /locus_tag="SynRCC307_0298"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27201"
FT                   /db_xref="GOA:A5GQP2"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP2"
FT                   /protein_id="CAK27201.1"
FT                   /translation="MWQTLIGFVVGNATSALIPPLTQAAMGIALYLTWVGGFLVTAVVL
FT                   TRLLKGIKLI"
     MWQTLIGFVV GNATSALIPP LTQAAMGIAL YLTWVGGFLV TAVVLTRLLK GIKLI             55
//

If you have problems or comments...

PBIL Back to PBIL home page