(data stored in ACNUC29543 zone)

EMBL: CT978603.PE302

CT978603.PE302       Location/Qualifiers
FT   CDS             297969..298922
FT                   /transl_table=11
FT                   /gene="SynRCC307_0302"
FT                   /locus_tag="SynRCC307_0302"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27205"
FT                   /db_xref="GOA:A5GQP6"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP6"
FT                   /protein_id="CAK27205.1"
FT                   /translation="MTASRQRPEPPFRRWVRPVMGGLATIGAIDTASITLERWGVIGEL
FT                   ACPGGADGCDKVLNSAWGTVLGQPLALFGFLAYLALVLLSLLPLIPAVQQWLIDRQSSS
FT                   GGLTARRFGRGPDLFWHLGYLLSLGMSVFSAALVGLMLFKIQAICAFCLLSAGLSLALW
FT                   LLHLLGREWEDSGQVLFRSVILVVLVGLLSLAWVASADRPAVLSEKGAPPVVTSVSNPA
FT                   KLALAEHLSSIGARMYSAYWCPHCHEQKELFGQEAAAKLDVIECATDGKNSQASLCQSK
FT                   AIEGFPSWEIKGQIDSGVKSLQKLADLSGYQGPRNF"
     MTASRQRPEP PFRRWVRPVM GGLATIGAID TASITLERWG VIGELACPGG ADGCDKVLNS        60
     AWGTVLGQPL ALFGFLAYLA LVLLSLLPLI PAVQQWLIDR QSSSGGLTAR RFGRGPDLFW       120
     HLGYLLSLGM SVFSAALVGL MLFKIQAICA FCLLSAGLSL ALWLLHLLGR EWEDSGQVLF       180
     RSVILVVLVG LLSLAWVASA DRPAVLSEKG APPVVTSVSN PAKLALAEHL SSIGARMYSA       240
     YWCPHCHEQK ELFGQEAAAK LDVIECATDG KNSQASLCQS KAIEGFPSWE IKGQIDSGVK       300
     SLQKLADLSG YQGPRNF                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page