(data stored in ACNUC29543 zone)

EMBL: CT978603.PE305

CT978603.PE305       Location/Qualifiers
FT   CDS             complement(301022..301726)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0305"
FT                   /locus_tag="SynRCC307_0305"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27208"
FT                   /db_xref="GOA:A5GQP9"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP9"
FT                   /protein_id="CAK27208.1"
FT                   /translation="MFTQLLFGAAPVLNPAPQLNAAGVSWKTSAPAMAAALVMLPVFAQ
FT                   APWVRSSPVACALFTAVLVALGLRLRGDLGALLIGFSGSWLAGAVFWGWMRMHPLWHLP
FT                   VEAFALPLAIAGLQGPWRRAGQFYLGALIGTACTDAATALCGLMPLWPQVLQASPSEAP
FT                   LLLSAAAEQVLQPLPLAVVSGFAAAMLAAGRWLWRQGEGGQVVAASLLSTLAVDALFLA
FT                   LALLSPQLSGLV"
     MFTQLLFGAA PVLNPAPQLN AAGVSWKTSA PAMAAALVML PVFAQAPWVR SSPVACALFT        60
     AVLVALGLRL RGDLGALLIG FSGSWLAGAV FWGWMRMHPL WHLPVEAFAL PLAIAGLQGP       120
     WRRAGQFYLG ALIGTACTDA ATALCGLMPL WPQVLQASPS EAPLLLSAAA EQVLQPLPLA       180
     VVSGFAAAML AAGRWLWRQG EGGQVVAASL LSTLAVDALF LALALLSPQL SGLV             234
//

If you have problems or comments...

PBIL Back to PBIL home page