(data stored in ACNUC29543 zone)

EMBL: CT978603.PE310

CT978603.PE310       Location/Qualifiers
FT   CDS             307325..308119
FT                   /transl_table=11
FT                   /gene="SynRCC307_0310"
FT                   /locus_tag="SynRCC307_0310"
FT                   /product="Inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27213"
FT                   /db_xref="GOA:A5GQQ4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ4"
FT                   /protein_id="CAK27213.1"
FT                   /translation="MATYPHGAHWPALHELVDRVAERQRADFGQIASTVKPDGSLVTDC
FT                   DRWSDATIAAGLAAILPGDGLLSEEGCTDSPTQRHGWIVDPLDGTTNFSVGLPIWAISM
FT                   ARLQDGQPLEAIIDVPPLRERYVAVRGQGVWRNGEPLQPPGGPRHRCNCASLCTRSLPV
FT                   LQKVPGRFPAKTRMLGVASLNLLGVGLGTMLAALEATPKIWDLAAVWLILEELGCVIRP
FT                   LADHPFPMTPGAPLGEASYPLMAACDEEHYQRFLPWGQALVS"
     MATYPHGAHW PALHELVDRV AERQRADFGQ IASTVKPDGS LVTDCDRWSD ATIAAGLAAI        60
     LPGDGLLSEE GCTDSPTQRH GWIVDPLDGT TNFSVGLPIW AISMARLQDG QPLEAIIDVP       120
     PLRERYVAVR GQGVWRNGEP LQPPGGPRHR CNCASLCTRS LPVLQKVPGR FPAKTRMLGV       180
     ASLNLLGVGL GTMLAALEAT PKIWDLAAVW LILEELGCVI RPLADHPFPM TPGAPLGEAS       240
     YPLMAACDEE HYQRFLPWGQ ALVS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page