(data stored in ACNUC29543 zone)

EMBL: CT978603.PE331

CT978603.PE331       Location/Qualifiers
FT   CDS             321263..321481
FT                   /transl_table=11
FT                   /gene="SynRCC307_0331"
FT                   /locus_tag="SynRCC307_0331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27234"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS5"
FT                   /protein_id="CAK27234.1"
FT                   /translation="MKLSFAVCITHPDRREETSFHESVLDAVEDYHSSVLKSALQGWDC
FT                   VALSLCINGQPVEVLESIEPLKNGRPH"
     MKLSFAVCIT HPDRREETSF HESVLDAVED YHSSVLKSAL QGWDCVALSL CINGQPVEVL        60
     ESIEPLKNGR PH                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page