(data stored in ACNUC29543 zone)

EMBL: CT978603.PE332

CT978603.PE332       Location/Qualifiers
FT   CDS             complement(321478..321657)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0332"
FT                   /locus_tag="SynRCC307_0332"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27235"
FT                   /db_xref="GOA:A5GQS6"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS6"
FT                   /protein_id="CAK27235.1"
FT                   /translation="MLPVFALLIPLLVFGIAFVSLYGQPLEGRLKWLSEHSAQIWIAGM
FT                   VFLITASLIIFLAR"
     MLPVFALLIP LLVFGIAFVS LYGQPLEGRL KWLSEHSAQI WIAGMVFLIT ASLIIFLAR         59
//

If you have problems or comments...

PBIL Back to PBIL home page