(data stored in ACNUC29543 zone)

EMBL: CT978603.PE336

CT978603.PE336       Location/Qualifiers
FT   CDS             complement(324084..324497)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0336"
FT                   /locus_tag="SynRCC307_0336"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27239"
FT                   /db_xref="GOA:A5GQT0"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT0"
FT                   /protein_id="CAK27239.1"
FT                   /translation="MASSGLTQVGERFRERFTELLPEIQERWPQVAHEALTNTRGSFDE
FT                   VVAVIAAQTGRTSAVVQEQLLEFMDVAGEQTRKLGDSLQPLEEQLERLLDDLNANLRPK
FT                   IESPVRERPLLAVGIAAGIGLLAGLILSGGRRR"
     MASSGLTQVG ERFRERFTEL LPEIQERWPQ VAHEALTNTR GSFDEVVAVI AAQTGRTSAV        60
     VQEQLLEFMD VAGEQTRKLG DSLQPLEEQL ERLLDDLNAN LRPKIESPVR ERPLLAVGIA       120
     AGIGLLAGLI LSGGRRR                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page