(data stored in ACNUC29543 zone)

EMBL: CT978603.PE34

CT978603.PE34        Location/Qualifiers
FT   CDS             complement(34950..35315)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0034"
FT                   /locus_tag="SynRCC307_0034"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26937"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX8"
FT                   /protein_id="CAK26937.1"
FT                   /translation="MNFRKLVESMARFECFSRTQRPDMDLLPIATEALQSQGFKVRSAI
FT                   GESISLVDSQPVKRLRDRAVVLLDQHTNPDGRRELQCVISNDSISSSPDCRCHGVFRQL
FT                   LGQFESMPDVVVEAAAA"
     MNFRKLVESM ARFECFSRTQ RPDMDLLPIA TEALQSQGFK VRSAIGESIS LVDSQPVKRL        60
     RDRAVVLLDQ HTNPDGRREL QCVISNDSIS SSPDCRCHGV FRQLLGQFES MPDVVVEAAA       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page