(data stored in ACNUC29543 zone)

EMBL: CT978603.PE350

CT978603.PE350       Location/Qualifiers
FT   CDS             337817..339382
FT                   /transl_table=11
FT                   /gene="SynRCC307_0350"
FT                   /locus_tag="SynRCC307_0350"
FT                   /product="Predicted ATPase with chaperone activity"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27253"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU4"
FT                   /protein_id="CAK27253.1"
FT                   /translation="MLAFCGAAALLGLEAHPVAVEVDLAPGLPGFQLVGLSDASGRDAR
FT                   ERVRSALRNSGFRPPQSRVVVSLAPADLPKQGAGFDLAIALALLVASGQLDPARLQAHW
FT                   AFGELSLDGSLRPVQGVLAVVLAAQQAAASGLILPQANASEAPVLDALPLYPASSLSAV
FT                   VAALQGRASWSSRPQLHPCQPPFVGVDLQQVLGQSQGRRAAELAAAGGHHLLLVGPPGC
FT                   GKTMLASALLGLLPPLDNEQALMVSHIHTMVGLRSAGAPLLHHPPFRAPHHSSTAAALV
FT                   GGGLGPRPGELTLAHHGLLFLDELAEFRRPVLDQLRQPLESGEVLIARAKQALRFPSQT
FT                   LLVGATNPCPCGWWGDPRQGCCCGQHRRQQYWNRISGPLLDRFDLQVSLRSDACASPSS
FT                   SPPEATAVVARRVHRARQRMRQRNPSGRCNGRLTAAQLNGCVQLSPQAEGWWRDERLAH
FT                   LLSGRRRHRLLAVAQTLADLAASPVVEPQHLAEALLFRSLERSVARDGGLDPGLAGRPG
FT                   VAAD"
     MLAFCGAAAL LGLEAHPVAV EVDLAPGLPG FQLVGLSDAS GRDARERVRS ALRNSGFRPP        60
     QSRVVVSLAP ADLPKQGAGF DLAIALALLV ASGQLDPARL QAHWAFGELS LDGSLRPVQG       120
     VLAVVLAAQQ AAASGLILPQ ANASEAPVLD ALPLYPASSL SAVVAALQGR ASWSSRPQLH       180
     PCQPPFVGVD LQQVLGQSQG RRAAELAAAG GHHLLLVGPP GCGKTMLASA LLGLLPPLDN       240
     EQALMVSHIH TMVGLRSAGA PLLHHPPFRA PHHSSTAAAL VGGGLGPRPG ELTLAHHGLL       300
     FLDELAEFRR PVLDQLRQPL ESGEVLIARA KQALRFPSQT LLVGATNPCP CGWWGDPRQG       360
     CCCGQHRRQQ YWNRISGPLL DRFDLQVSLR SDACASPSSS PPEATAVVAR RVHRARQRMR       420
     QRNPSGRCNG RLTAAQLNGC VQLSPQAEGW WRDERLAHLL SGRRRHRLLA VAQTLADLAA       480
     SPVVEPQHLA EALLFRSLER SVARDGGLDP GLAGRPGVAA D                           521
//

If you have problems or comments...

PBIL Back to PBIL home page