(data stored in ACNUC29543 zone)

EMBL: CT978603.PE353

CT978603.PE353       Location/Qualifiers
FT   CDS             complement(340022..340585)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0353"
FT                   /locus_tag="SynRCC307_0353"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27256"
FT                   /db_xref="InterPro:IPR022222"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU7"
FT                   /protein_id="CAK27256.1"
FT                   /translation="MLSAFRRLAPALVGLASATTALLSQPAQAGLFDAKEVETTQFVLV
FT                   AAPIPSGGAQLNIYEQKKDTRPCFSREGNAPTTVKPLLATFDFTGICGRYMDSNGYSVR
FT                   IGEIDYGSAMRLRVEILEEDIVLMSTGPNGGEVVMARAGGIDDGYVELKLEPGWSLKRR
FT                   HYGERALGHLYVHNESLPIRRDQE"
     MLSAFRRLAP ALVGLASATT ALLSQPAQAG LFDAKEVETT QFVLVAAPIP SGGAQLNIYE        60
     QKKDTRPCFS REGNAPTTVK PLLATFDFTG ICGRYMDSNG YSVRIGEIDY GSAMRLRVEI       120
     LEEDIVLMST GPNGGEVVMA RAGGIDDGYV ELKLEPGWSL KRRHYGERAL GHLYVHNESL       180
     PIRRDQE                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page