(data stored in ACNUC29543 zone)

EMBL: CT978603.PE354

CT978603.PE354       Location/Qualifiers
FT   CDS             complement(340648..340845)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0354"
FT                   /locus_tag="SynRCC307_0354"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27257"
FT                   /db_xref="GOA:A5GQU8"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU8"
FT                   /protein_id="CAK27257.1"
FT                   /translation="MPMKPLAGLFLALACVLGIAATGCVFELAYGDPDLGIGVTRGILI
FT                   GALPGCAGSLLVAIRLNTPA"
     MPMKPLAGLF LALACVLGIA ATGCVFELAY GDPDLGIGVT RGILIGALPG CAGSLLVAIR        60
     LNTPA                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page