(data stored in ACNUC29543 zone)

EMBL: CT978603.PE36

CT978603.PE36        Location/Qualifiers
FT   CDS             36426..36596
FT                   /transl_table=11
FT                   /gene="SynRCC307_0036"
FT                   /locus_tag="SynRCC307_0036"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26939"
FT                   /db_xref="GOA:A5GPY0"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY0"
FT                   /protein_id="CAK26939.1"
FT                   /translation="MTCSTIIPAAQPRRAWLSPVVLAAAIAAAGLLLPEEPQLQAELCQ
FT                   RTSSVKACQVW"
     MTCSTIIPAA QPRRAWLSPV VLAAAIAAAG LLLPEEPQLQ AELCQRTSSV KACQVW            56
//

If you have problems or comments...

PBIL Back to PBIL home page