(data stored in ACNUC29543 zone)

EMBL: CT978603.PE362

CT978603.PE362       Location/Qualifiers
FT   CDS             complement(347590..347781)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0362"
FT                   /locus_tag="SynRCC307_0362"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27265"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV6"
FT                   /protein_id="CAK27265.1"
FT                   /translation="MKFFCCYDGEGTLLARCQTMADVEVLRRLGRPVIKVVEMEPEEAV
FT                   VCRMTDAPVSPRAFNEEY"
     MKFFCCYDGE GTLLARCQTM ADVEVLRRLG RPVIKVVEME PEEAVVCRMT DAPVSPRAFN        60
     EEY                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page