(data stored in ACNUC29543 zone)

EMBL: CT978603.PE365

CT978603.PE365       Location/Qualifiers
FT   CDS             complement(354903..355622)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0365"
FT                   /locus_tag="SynRCC307_0365"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27268"
FT                   /db_xref="GOA:A5GQV9"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV9"
FT                   /protein_id="CAK27268.1"
FT                   /translation="MKTPMARSRPAPNLMAELLDLPVVSAGLRTAQSQGVHWGRQLLEQ
FT                   HADLGRDGMVEHAIRRAMWRTAGTGALAGLGGVLTLPAGGGDLLYFLYAEIELSAAIFT
FT                   VFGVELDDEQHRPILLAAAMGLGVNEMVRLIGSRLGERAARQLLLQLSREASQMLQRLV
FT                   GQRLVTHLARRGWLGLGRLVPLTGALVGGSLNAVLIRTAGEAMRHTAREYKRFLDDHGR
FT                   VDPVDVVVLDINADTAG"
     MKTPMARSRP APNLMAELLD LPVVSAGLRT AQSQGVHWGR QLLEQHADLG RDGMVEHAIR        60
     RAMWRTAGTG ALAGLGGVLT LPAGGGDLLY FLYAEIELSA AIFTVFGVEL DDEQHRPILL       120
     AAAMGLGVNE MVRLIGSRLG ERAARQLLLQ LSREASQMLQ RLVGQRLVTH LARRGWLGLG       180
     RLVPLTGALV GGSLNAVLIR TAGEAMRHTA REYKRFLDDH GRVDPVDVVV LDINADTAG        239
//

If you have problems or comments...

PBIL Back to PBIL home page