(data stored in ACNUC29543 zone)

EMBL: CT978603.PE369

CT978603.PE369       Location/Qualifiers
FT   CDS             complement(357361..357534)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0369"
FT                   /locus_tag="SynRCC307_0369"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27272"
FT                   /db_xref="GOA:A5GQW3"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW3"
FT                   /protein_id="CAK27272.1"
FT                   /translation="MKLFVDNRRDGSRLLSSALAFSFVGLIRIDTSWGRVLFVAAGALS
FT                   LWWWLCYRKLTH"
     MKLFVDNRRD GSRLLSSALA FSFVGLIRID TSWGRVLFVA AGALSLWWWL CYRKLTH           57
//

If you have problems or comments...

PBIL Back to PBIL home page