(data stored in ACNUC29543 zone)

EMBL: CT978603.PE376

CT978603.PE376       Location/Qualifiers
FT   CDS             361134..361337
FT                   /transl_table=11
FT                   /gene="SynRCC307_0376"
FT                   /locus_tag="SynRCC307_0376"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27279"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX0"
FT                   /protein_id="CAK27279.1"
FT                   /translation="MRPIDSTFVARQRLALALSLQGNRSWLAARRAQLLEEGRVLEAEA
FT                   LLQEFRGLGQPDQLLTVPAQLG"
     MRPIDSTFVA RQRLALALSL QGNRSWLAAR RAQLLEEGRV LEAEALLQEF RGLGQPDQLL        60
     TVPAQLG                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page